Lineage for d1p2qb_ (1p2q B:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637270Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 2637271Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 2637272Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 2637309Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)
  7. 2637310Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)
  8. 2637354Domain d1p2qb_: 1p2q B: [93953]
    Other proteins in same PDB: d1p2qa_, d1p2qc_
    complexed with so4, trs

Details for d1p2qb_

PDB Entry: 1p2q (more details), 1.8 Å

PDB Description: structural consequences of accommodation of four non-cognate amino- acid residues in the s1 pocket of bovine trypsin and chymotrypsin
PDB Compounds: (B:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d1p2qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2qb_ g.8.1.1 (B:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpcfariiryfynakaglcqtfvyggcrakrnnfksaedclrtcgga

SCOPe Domain Coordinates for d1p2qb_:

Click to download the PDB-style file with coordinates for d1p2qb_.
(The format of our PDB-style files is described here.)

Timeline for d1p2qb_: