![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (7 families) ![]() |
![]() | Family d.2.1.2: C-type lysozyme [53960] (2 proteins) |
![]() | Protein Lysozyme [53961] (14 species) ubiquitous in a variety of tissues and secretions |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [53962] (256 PDB entries) |
![]() | Domain d1p2cf_: 1p2c F: [93924] Other proteins in same PDB: d1p2ca1, d1p2ca2, d1p2cb1, d1p2cb2, d1p2cd1, d1p2cd2, d1p2ce1, d1p2ce2 |
PDB Entry: 1p2c (more details), 2 Å
SCOP Domain Sequences for d1p2cf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p2cf_ d.2.1.2 (F:) Lysozyme {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d1p2cf_: