SCOPe 2.06: Domain d1p2ce1: 1p2c E:1201-1316

Lineage for d1p2ce1 (1p2c E:1201-1316)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1p2ce1: 1p2c E:1201-1316 [93922]
   Other proteins in same PDB: d1p2ca1, d1p2ca2, d1p2cb2, d1p2cc_, d1p2cd1, d1p2cd2, d1p2ce2, d1p2cf_
   part of anti-lysozyme Fab F10.6.6

Details for d1p2ce1

PDB Entry: 1p2c, 2 Å

PDB Description: crystal structure analysis of an anti-lysozyme antibody

PDB Compounds: (E:) heavy chain VH+CH1 anti-lysozyme antibody F10.6.6

SCOPe Domain Sequences for d1p2ce1:

Sequence; same for both SEQRES and ATOM records:

>d1p2ce1 b.1.1.1 (E:1201-1316) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqesgaelmkpgasvkisckatgytfttywiewikqrpghslewigeilpgsdstyy
nekvkgkvtftadassntaymqlssltsedsavyycargdgfyvywgqgttltvss

Timeline for d1p2ce1:

• d1p2ce1 first appeared in SCOP 1.67
  
• d1p2ce1 appears in SCOPe 2.05
  
• d1p2ce1 appears in SCOPe 2.07
  
• d1p2ce1 appears in the current release, SCOPe 2.08