Lineage for d1p2ca2 (1p2c A:108-212)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656190Domain d1p2ca2: 1p2c A:108-212 [93916]
    Other proteins in same PDB: d1p2ca1, d1p2cb1, d1p2cb2, d1p2cc_, d1p2cd1, d1p2ce1, d1p2ce2, d1p2cf_

Details for d1p2ca2

PDB Entry: 1p2c (more details), 2 Å

PDB Description: crystal structure analysis of an anti-lysozyme antibody
PDB Compounds: (A:) light chain anti-lysozyme antibody F10.6.6

SCOP Domain Sequences for d1p2ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p2ca2 b.1.1.2 (A:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1p2ca2:

Click to download the PDB-style file with coordinates for d1p2ca2.
(The format of our PDB-style files is described here.)

Timeline for d1p2ca2: