Lineage for d1p28b_ (1p28 B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 443131Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 443132Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 443150Protein Pheromone binding protein PBPLma [101188] (1 species)
  7. 443151Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)
  8. 443153Domain d1p28b_: 1p28 B: [93912]

Details for d1p28b_

PDB Entry: 1p28 (more details), 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with a component of the pheromonal blend: 3-hydroxy-butan-2-one.

SCOP Domain Sequences for d1p28b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p28b_ a.39.2.1 (B:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae)}
tqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispegai
ytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

SCOP Domain Coordinates for d1p28b_:

Click to download the PDB-style file with coordinates for d1p28b_.
(The format of our PDB-style files is described here.)

Timeline for d1p28b_: