Lineage for d1p28a1 (1p28 A:1-117)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325006Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2325007Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2325045Protein Pheromone binding protein PBPLma [101188] (1 species)
  7. 2325046Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)
  8. 2325047Domain d1p28a1: 1p28 A:1-117 [93911]
    Other proteins in same PDB: d1p28a2
    complexed with hbr, hbs

Details for d1p28a1

PDB Entry: 1p28 (more details), 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with a component of the pheromonal blend: 3-hydroxy-butan-2-one.
PDB Compounds: (A:) pheromone binding protein

SCOPe Domain Sequences for d1p28a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p28a1 a.39.2.1 (A:1-117) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae) [TaxId: 36963]}
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrns

SCOPe Domain Coordinates for d1p28a1:

Click to download the PDB-style file with coordinates for d1p28a1.
(The format of our PDB-style files is described here.)

Timeline for d1p28a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p28a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p28b_