SCOPe 2.05: Domain d1p27c_: 1p27 C:

Lineage for d1p27c_ (1p27 C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.232: Mago nashi protein [89816] (1 superfamily)
   beta(4)-alpha-beta(2)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, order: 651234

4. Superfamily d.232.1: Mago nashi protein [89817] (1 family)
   automatically mapped to Pfam PF02792

5. Family d.232.1.1: Mago nashi protein [89818] (1 protein)

6. Protein Mago nashi protein [89819] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102750] (5 PDB entries)

8. Domain d1p27c_: 1p27 C: [93909]
   Other proteins in same PDB: d1p27b_, d1p27d_
   protein/RNA complex

Details for d1p27c_

PDB Entry: 1p27, 2 Å

PDB Description: Crystal Structure of the Human Y14/Magoh complex

PDB Compounds: (C:) Mago nashi protein homolog

SCOPe Domain Sequences for d1p27c_:

Sequence; same for both SEQRES and ATOM records:

>d1p27c_ d.232.1.1 (C:) Mago nashi protein {Human (Homo sapiens) [TaxId: 9606]}
esdfylryyvghkgkfgheflefefrpdgklryannsnykndvmirkeayvhksvmeelk
riiddseitkeddalwpppdrvgrqeleivigdehisfttskigslidvnqskdpeglrv
fyylvqdlkclvfsliglhfkikp

Timeline for d1p27c_:

• d1p27c_ first appeared in SCOP 1.67
  
• d1p27c_ appears in SCOPe 2.04
  
• d1p27c_ appears in SCOPe 2.06
  
• d1p27c_ appears in the current release, SCOPe 2.08