SCOPe 2.07: Domain d1p0ze1: 1p0z E:5-133

Lineage for d1p0ze1 (1p0z E:5-133)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (5 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)

6. Protein Sensor kinase CitA [103192] (1 species)
   citrate-binding domain

7. Species Klebsiella pneumoniae [TaxId:573] [103193] (1 PDB entry)

8. Domain d1p0ze1: 1p0z E:5-133 [93886]
   Other proteins in same PDB: d1p0za2, d1p0zb2, d1p0zc2, d1p0zd2, d1p0ze2, d1p0zf2, d1p0zg2, d1p0zh2, d1p0zi2, d1p0zj2
   complexed with flc, mo7, na, omo

Details for d1p0ze1

PDB Entry: 1p0z, 1.6 Å

PDB Description: Sensor Kinase CitA binding domain

PDB Compounds: (E:) Sensor kinase citA

SCOPe Domain Sequences for d1p0ze1:

Sequence; same for both SEQRES and ATOM records:

>d1p0ze1 d.110.6.1 (E:5-133) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]}
eerlhyqvgqraliqamqisampelveavqkrdlarikalidpmrsfsdatyitvgdasg
qrlyhvnpdeigksmeggdsdealinaksyvsvrkgslgsslrgkspiqdatgkvigivs
vgytieqle

Timeline for d1p0ze1:

• d1p0ze1 first appeared in SCOP 1.67, called d1p0ze_
  
• d1p0ze1 appears in SCOPe 2.06
  
• d1p0ze1 appears in the current release, SCOPe 2.08