![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein) |
![]() | Protein Ecotin, trypsin inhibitor [49774] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
![]() | Domain d1p0se_: 1p0s E: [93872] Other proteins in same PDB: d1p0sh_, d1p0sl1, d1p0sl2 complexed with mg, na; mutant |
PDB Entry: 1p0s (more details), 2.8 Å
SCOP Domain Sequences for d1p0se_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0se_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} vqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenkt legwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnv dvkyrvwkaeekidnavvr
Timeline for d1p0se_: