SCOP 1.69: Domain d1p0se_: 1p0s E:

Lineage for d1p0se_ (1p0s E:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (1 protein)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (14 PDB entries)

8. Domain d1p0se_: 1p0s E: [93872]
   Other proteins in same PDB: d1p0sh_, d1p0sl1, d1p0sl2

Details for d1p0se_

PDB Entry: 1p0s, 2.8 Å

PDB Description: crystal structure of blood coagulation factor xa in complex with ecotin m84r

SCOP Domain Sequences for d1p0se_:

Sequence; same for both SEQRES and ATOM records:

>d1p0se_ b.16.1.1 (E:) Ecotin, trypsin inhibitor {Escherichia coli}
vqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenkt
legwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdnv
dvkyrvwkaeekidnavvr

Timeline for d1p0se_:

• d1p0se_ first appeared in SCOP 1.67
  
• d1p0se_ appears in SCOP 1.71
  
• d1p0se_ appears in the current release, SCOPe 2.08