Lineage for d1ozha1 (1ozh A:188-366)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694262Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 694327Protein Catabolic acetolactate synthase [102288] (1 species)
  7. 694328Species Klebsiella pneumoniae [TaxId:573] [102289] (3 PDB entries)
  8. 694329Domain d1ozha1: 1ozh A:188-366 [93833]
    Other proteins in same PDB: d1ozha2, d1ozha3, d1ozhb2, d1ozhb3, d1ozhc2, d1ozhc3, d1ozhd2, d1ozhd3

Details for d1ozha1

PDB Entry: 1ozh (more details), 2 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate.
PDB Compounds: (A:) Acetolactate synthase, catabolic

SCOP Domain Sequences for d1ozha1:

Sequence, based on SEQRES records: (download)

>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

Sequence, based on observed residues (ATOM records): (download)

>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrgaql

SCOP Domain Coordinates for d1ozha1:

Click to download the PDB-style file with coordinates for d1ozha1.
(The format of our PDB-style files is described here.)

Timeline for d1ozha1: