Lineage for d1ozgb2 (1ozg B:5-187)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694612Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 694677Protein Catabolic acetolactate synthase [102328] (1 species)
  7. 694678Species Klebsiella pneumoniae [TaxId:573] [102329] (3 PDB entries)
  8. 694686Domain d1ozgb2: 1ozg B:5-187 [93831]
    Other proteins in same PDB: d1ozga1, d1ozga3, d1ozgb1, d1ozgb3
    complexed with he3, mg, peg, po4

Details for d1ozgb2

PDB Entry: 1ozg (more details), 2.3 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate
PDB Compounds: (B:) Acetolactate synthase, catabolic

SCOP Domain Sequences for d1ozgb2:

Sequence, based on SEQRES records: (download)

>d1ozgb2 c.36.1.5 (B:5-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma
aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdt
vamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpas
gap

Sequence, based on observed residues (ATOM records): (download)

>d1ozgb2 c.36.1.5 (B:5-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma
aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqsmdtvam
fspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasap

SCOP Domain Coordinates for d1ozgb2:

Click to download the PDB-style file with coordinates for d1ozgb2.
(The format of our PDB-style files is described here.)

Timeline for d1ozgb2: