Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology |
Protein Catabolic acetolactate synthase [102328] (1 species) |
Species Klebsiella pneumoniae [TaxId:573] [102329] (3 PDB entries) |
Domain d1ozgb2: 1ozg B:5-187 [93831] Other proteins in same PDB: d1ozga1, d1ozga3, d1ozgb1, d1ozgb3 complexed with he3, mg, peg, po4 |
PDB Entry: 1ozg (more details), 2.3 Å
SCOP Domain Sequences for d1ozgb2:
Sequence, based on SEQRES records: (download)
>d1ozgb2 c.36.1.5 (B:5-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqvhqsmdt vamfspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpas gap
>d1ozgb2 c.36.1.5 (B:5-187) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} ypvrqwahgadlvvsqleaqgvrqvfgipgakidkvfdslldssiriipvrheanaafma aavgritgkagvalvtsgpgcsnlitgmatansegdpvvalggavkradkakqsmdtvam fspvtkyaievtapdalaevvsnafraaeqgrpgsafvslpqdvvdgpvsgkvlpasap
Timeline for d1ozgb2: