| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
| Protein Catabolic acetolactate synthase [102333] (1 species) |
| Species Klebsiella pneumoniae [TaxId:573] [102334] (3 PDB entries) |
| Domain d1ozga3: 1ozg A:367-554 [93829] Other proteins in same PDB: d1ozga1, d1ozga2, d1ozgb1, d1ozgb2 complexed with he3, mg, peg, po4 |
PDB Entry: 1ozg (more details), 2.3 Å
SCOPe Domain Sequences for d1ozga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ozga3 c.36.1.9 (A:367-554) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
nqfalhplrivramqdivnsdvtltvdmgsfhiwiarylytfrarqvmisngqqtmgval
pwaigawlvnperkvvsvsgdggflqssmeletavrlkanvlhliwvdngynmvaiqeek
kyqrlsgvefgpmdfkayaesfgakgfavesaealeptlraamdvdgpavvaipvdyrdn
pllmgqlh
Timeline for d1ozga3: