Lineage for d1ozfb1 (1ozf B:188-366)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694262Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 694327Protein Catabolic acetolactate synthase [102288] (1 species)
  7. 694328Species Klebsiella pneumoniae [TaxId:573] [102289] (3 PDB entries)
  8. 694334Domain d1ozfb1: 1ozf B:188-366 [93824]
    Other proteins in same PDB: d1ozfa2, d1ozfa3, d1ozfb2, d1ozfb3
    complexed with mg, peg, po4, tpp

Details for d1ozfb1

PDB Entry: 1ozf (more details), 2.3 Å

PDB Description: The crystal structure of Klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors
PDB Compounds: (B:) Acetolactate synthase, catabolic

SCOP Domain Sequences for d1ozfb1:

Sequence, based on SEQRES records: (download)

>d1ozfb1 c.31.1.3 (B:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldrrgaql

Sequence, based on observed residues (ATOM records): (download)

>d1ozfb1 c.31.1.3 (B:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]}
qmgaapddaidqvakliaqaknpifllglmasqpenskalrrlletshipvtstyqaaga
vnqdnfsrfagrvglfnnqagdrllqladlvicigyspveyepamwnsgnatlvhidvlp
ayeernytpdvelvgdiagtlnklaqnidhrlvlspqaaeilrdrqhqrelldraql

SCOP Domain Coordinates for d1ozfb1:

Click to download the PDB-style file with coordinates for d1ozfb1.
(The format of our PDB-style files is described here.)

Timeline for d1ozfb1: