Lineage for d1oz6a_ (1oz6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733215Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [101486] (1 PDB entry)
  8. 2733216Domain d1oz6a_: 1oz6 A: [93805]
    complexed with ca

Details for d1oz6a_

PDB Entry: 1oz6 (more details), 2.6 Å

PDB Description: X-ray structure of acidic phospholipase A2 from Indian saw-scaled viper (Echis carinatus) with a potent platelet aggregation inhibitory activity
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1oz6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
nlyqfgrmiwnrtgklpilsygsygcycgwggqgppkdatdrcclvhdccytrvgdcspk
mtlysyrfengdiicdnkdpckravcecdreaaiclgenvntydkkyksyedcteevqec

SCOPe Domain Coordinates for d1oz6a_:

Click to download the PDB-style file with coordinates for d1oz6a_.
(The format of our PDB-style files is described here.)

Timeline for d1oz6a_: