SCOPe 2.05: Domain d1oysa2: 1oys A:152-237

Lineage for d1oysa2 (1oys A:152-237)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)

6. Protein Ribonuclease PH, domain 2 [103150] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries)

8. Domain d1oysa2: 1oys A:152-237 [93759]
   Other proteins in same PDB: d1oysa1

Details for d1oysa2

PDB Entry: 1oys, 2.4 Å

PDB Description: crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis

PDB Compounds: (A:) Ribonuclease PH

SCOPe Domain Sequences for d1oysa2:

Sequence; same for both SEQRES and ATOM records:

>d1oysa2 d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]}
tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs
redlngllglaekgiqelidkqkevl

Timeline for d1oysa2:

• d1oysa2 first appeared in SCOP 1.67
  
• d1oysa2 appears in SCOPe 2.04
  
• d1oysa2 appears in SCOPe 2.06
  
• d1oysa2 appears in the current release, SCOPe 2.08