SCOP 1.75: Domain d1oypf1: 1oyp F:1-151

Lineage for d1oypf1 (1oyp F:1-151)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (10 proteins)

6. Protein Ribonuclease PH, domain 1 [102758] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)

8. Domain d1oypf1: 1oyp F:1-151 [93744]
   Other proteins in same PDB: d1oypa2, d1oypb2, d1oypc2, d1oypd2, d1oype2, d1oypf2
   complexed with sul

Details for d1oypf1

PDB Entry: 1oyp, 2.76 Å

PDB Description: Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

PDB Compounds: (F:) Ribonuclease PH

SCOP Domain Sequences for d1oypf1:

Sequence, based on SEQRES records:

>d1oypf1 d.14.1.4 (F:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

Sequence, based on observed residues (ATOM records):

>d1oypf1 d.14.1.4 (F:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlsgrtmeiqrligralravvdleklgertiwidcdviqadggtrtasitgaflam
aiaigklikagtik

Timeline for d1oypf1:

• d1oypf1 first appeared in SCOP 1.67
  
• d1oypf1 appears in SCOP 1.73
  
• d1oypf1 appears in SCOPe 2.01
  
• d1oypf1 appears in the current release, SCOPe 2.08