Lineage for d1oylb_ (1oyl B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361144Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 361145Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 361146Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (2 proteins)
  6. 361155Protein Heme oxygenase-1 (HO-1) [48615] (2 species)
  7. 361156Species Human (Homo sapiens) [TaxId:9606] [48616] (9 PDB entries)
  8. 361164Domain d1oylb_: 1oyl B: [93733]
    complexed with hem; mutant

Details for d1oylb_

PDB Entry: 1oyl (more details), 1.59 Å

PDB Description: Crystal Structures of the Ferric, Ferrous, and Ferrous-NO Forms of the Asp140Ala Mutant of Human Heme Oxygenase-1: Catalytic Implications

SCOP Domain Sequences for d1oylb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oylb_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgalsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOP Domain Coordinates for d1oylb_:

Click to download the PDB-style file with coordinates for d1oylb_.
(The format of our PDB-style files is described here.)

Timeline for d1oylb_: