Lineage for d1oyla_ (1oyl A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925023Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 925024Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 925025Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
  6. 925061Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 925062Species Human (Homo sapiens) [TaxId:9606] [48616] (23 PDB entries)
    Uniprot P09601
  8. 925071Domain d1oyla_: 1oyl A: [93732]
    complexed with hem; mutant

Details for d1oyla_

PDB Entry: 1oyl (more details), 1.59 Å

PDB Description: crystal structures of the ferric, ferrous, and ferrous-no forms of the asp140ala mutant of human heme oxygenase-1: catalytic implications
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d1oyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyla_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgalsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d1oyla_:

Click to download the PDB-style file with coordinates for d1oyla_.
(The format of our PDB-style files is described here.)

Timeline for d1oyla_: