Lineage for d1oxxk2 (1oxx K:1-242)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697205Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 697284Protein Glucose transport protein GlcV, N-terminal domain [89681] (1 species)
  7. 697285Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89682] (5 PDB entries)
  8. 697286Domain d1oxxk2: 1oxx K:1-242 [93716]
    Other proteins in same PDB: d1oxxk1
    complexed with iod; mutant

Details for d1oxxk2

PDB Entry: 1oxx (more details), 1.45 Å

PDB Description: crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
PDB Compounds: (K:) ABC transporter, ATP binding protein

SCOP Domain Sequences for d1oxxk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
mvriivknvskvfkkgkvvaldnvniniengerfgilgpsgagkttfmriiagldvpstg
elyfddrlvasngklivppedrkigmvfqtwalypnltafeniafpltnmkmskeeirkr
veevakildihhvlnhfprelsgaqqqrvalaralvkdpslllldepfsnldarmrdsar
alvkevqsrlgvtllvvshdpadifaiadrvgvlvkgklvqvgkpedlydnpvsiqvasl
ig

SCOP Domain Coordinates for d1oxxk2:

Click to download the PDB-style file with coordinates for d1oxxk2.
(The format of our PDB-style files is described here.)

Timeline for d1oxxk2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oxxk1