Lineage for d1oxki_ (1oxk I:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765604Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (6 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 765612Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 765625Protein Phosphorelay protein ypd1 [47231] (1 species)
  7. 765626Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47232] (6 PDB entries)
  8. 765634Domain d1oxki_: 1oxk I: [93698]
    Other proteins in same PDB: d1oxkb_, d1oxkd_, d1oxkf_, d1oxkh_, d1oxkj_, d1oxkl_

Details for d1oxki_

PDB Entry: 1oxk (more details), 2.1 Å

PDB Description: Complex between YPD1 and SLN1 response regulator domain in space group P3(2)
PDB Compounds: (I:) Ypd1p

SCOP Domain Sequences for d1oxki_:

Sequence, based on SEQRES records: (download)

>d1oxki_ a.24.10.2 (I:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldn
lghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedd
eeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

Sequence, based on observed residues (ATOM records): (download)

>d1oxki_ a.24.10.2 (I:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stipseiinwtilneiismddfskgliiqfidqaqttfaqmqrqldgeknlteldnlghf
lkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginideddeeik
densiyliliakalnqsrlefklarielskyyntnl

SCOP Domain Coordinates for d1oxki_:

Click to download the PDB-style file with coordinates for d1oxki_.
(The format of our PDB-style files is described here.)

Timeline for d1oxki_: