SCOP 1.69: Domain d1ow4b_: 1ow4 B:

Lineage for d1ow4b_ (1ow4 B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)

6. Protein Pheromone binding protein PBPLma [101188] (1 species)

7. Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)

8. Domain d1ow4b_: 1ow4 B: [93629]

Details for d1ow4b_

PDB Entry: 1ow4, 1.6 Å

PDB Description: Crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae in complex with the fluorescent reporter ANS (1-anilinonaphtalene-8-sulfonic acid),

SCOP Domain Sequences for d1ow4b_:

Sequence; same for both SEQRES and ATOM records:

>d1ow4b_ a.39.2.1 (B:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae)}
sstqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispeg
aiytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

Timeline for d1ow4b_:

• d1ow4b_ first appeared in SCOP 1.67
  
• d1ow4b_ appears in SCOP 1.71
  
• d1ow4b_ appears in the current release, SCOPe 2.08, called d1ow4b1