Lineage for d1ovya_ (1ovy A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1860419Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 1860420Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 1860421Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 1860422Species Bacillus stearothermophilus [TaxId:1422] [102495] (1 PDB entry)
  8. 1860423Domain d1ovya_: 1ovy A: [93624]

Details for d1ovya_

PDB Entry: 1ovy (more details)

PDB Description: solution structure of ribosomal protein l18 from bacillus stearothermophilus
PDB Compounds: (A:) 50S ribosomal protein L18

SCOPe Domain Sequences for d1ovya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Bacillus stearothermophilus [TaxId: 1422]}
gtterprlsvfrsnkhiyaqiiddtksativsastldkefgldstnnieaakkvgelvak
ralekgikqvvfdrggylyhgrvkaladaareaglef

SCOPe Domain Coordinates for d1ovya_:

Click to download the PDB-style file with coordinates for d1ovya_.
(The format of our PDB-style files is described here.)

Timeline for d1ovya_: