Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
Species Bacillus stearothermophilus [TaxId:1422] [102495] (1 PDB entry) |
Domain d1ovya_: 1ovy A: [93624] |
PDB Entry: 1ovy (more details)
SCOPe Domain Sequences for d1ovya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ovya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Bacillus stearothermophilus [TaxId: 1422]} gtterprlsvfrsnkhiyaqiiddtksativsastldkefgldstnnieaakkvgelvak ralekgikqvvfdrggylyhgrvkaladaareaglef
Timeline for d1ovya_: