Lineage for d1ouya_ (1ouy A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043162Protein MAP kinase p38 [56129] (2 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 1043163Species Human (Homo sapiens) [TaxId:9606] [56130] (136 PDB entries)
  8. 1043277Domain d1ouya_: 1ouy A: [93579]
    complexed with 094

Details for d1ouya_

PDB Entry: 1ouy (more details), 2.5 Å

PDB Description: the structure of p38 alpha in complex with a dihydropyrido-pyrimidine inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d1ouya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ouya_ d.144.1.7 (A:) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppl

SCOPe Domain Coordinates for d1ouya_:

Click to download the PDB-style file with coordinates for d1ouya_.
(The format of our PDB-style files is described here.)

Timeline for d1ouya_: