Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.1: Internalin LRR domain [52059] (4 proteins) capped at the N-end with a truncated EF-hand subdomain this is a repeat family; one repeat unit is 2omx A:261-239 found in domain |
Protein Internalin B [52060] (1 species) |
Species Listeria monocytogenes [TaxId:1639] [52061] (6 PDB entries) |
Domain d1otna_: 1otn A: [93524] complexed with ca; mutant |
PDB Entry: 1otn (more details), 1.97 Å
SCOPe Domain Sequences for d1otna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otna_ c.10.2.1 (A:) Internalin B {Listeria monocytogenes [TaxId: 1639]} etitvstpikqifpdaafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiq ylpnvtklflngnkltdikpltnlknlgwlfldenkikdlsslkdlkklkslslehngis dinglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyl sknhisdlralaglknldvlelfsqec
Timeline for d1otna_: