Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins) |
Protein Phenylacetic acid degradation protein PaaC [101136] (1 species) |
Species Escherichia coli [TaxId:562] [101137] (1 PDB entry) |
Domain d1otkb_: 1otk B: [93522] structural genomics |
PDB Entry: 1otk (more details), 2 Å
SCOP Domain Sequences for d1otkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otkb_ a.25.1.2 (B:) Phenylacetic acid degradation protein PaaC {Escherichia coli [TaxId: 562]} hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl qrvl
Timeline for d1otkb_: