SCOP 1.73: Domain d1otkb_: 1otk B:

Lineage for d1otkb_ (1otk B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Phenylacetic acid degradation protein PaaC [101136] (1 species)

7. Species Escherichia coli [TaxId:562] [101137] (1 PDB entry)

8. Domain d1otkb_: 1otk B: [93522]
   structural genomics

Details for d1otkb_

PDB Entry: 1otk, 2 Å

PDB Description: structural genomics, protein paac

PDB Compounds: (B:) Phenylacetic acid degradation protein paaC

SCOP Domain Sequences for d1otkb_:

Sequence; same for both SEQRES and ATOM records:

>d1otkb_ a.25.1.2 (B:) Phenylacetic acid degradation protein PaaC {Escherichia coli [TaxId: 562]}
hgnqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaael
agegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpql
aaisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidial
seegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqyl
qrvl

Timeline for d1otkb_:

• d1otkb_ first appeared in SCOP 1.67
  
• d1otkb_ appears in SCOP 1.71
  
• d1otkb_ appears in SCOP 1.75
  
• d1otkb_ appears in the current release, SCOPe 2.08, called d1otkb1