Lineage for d1os9f1 (1os9 F:106-268)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205733Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2205734Species Human (Homo sapiens) [TaxId:9606] [69781] (39 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2205759Domain d1os9f1: 1os9 F:106-268 [93487]
    Other proteins in same PDB: d1os9a2, d1os9b2, d1os9c2, d1os9d2, d1os9e2, d1os9f2
    complexed with ca, zn

Details for d1os9f1

PDB Entry: 1os9 (more details), 1.85 Å

PDB Description: binary enzyme-product complexes of human mmp12
PDB Compounds: (F:) Macrophage metalloelastase

SCOPe Domain Sequences for d1os9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os9f1 d.92.1.11 (F:106-268) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygdpken

SCOPe Domain Coordinates for d1os9f1:

Click to download the PDB-style file with coordinates for d1os9f1.
(The format of our PDB-style files is described here.)

Timeline for d1os9f1: