SCOPe 2.07: Domain d1orjb_: 1orj B:

Lineage for d1orjb_ (1orj B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families)
   can form closed, open and helix-swapped bundles

5. Family a.24.19.1: Flagellar export chaperone FliS [101117] (1 protein)
   automatically mapped to Pfam PF02561

6. Protein Flagellar export chaperone FliS [101118] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [101119] (2 PDB entries)

8. Domain d1orjb_: 1orj B: [93457]
   Other proteins in same PDB: d1orja2, d1orjd2

Details for d1orjb_

PDB Entry: 1orj, 2.25 Å

PDB Description: flagellar export chaperone

PDB Compounds: (B:) flagellar protein FliS

SCOPe Domain Sequences for d1orjb_:

Sequence; same for both SEQRES and ATOM records:

>d1orjb_ a.24.19.1 (B:) Flagellar export chaperone FliS {Aquifex aeolicus [TaxId: 63363]}
pleqiillydkaiecleraieiydqvnelekrkefvenidrvydiisalksfldhekgke
iaknldtiytiilntlvkvdktkeelqkileilkdlreaweevkk

Timeline for d1orjb_:

• d1orjb_ first appeared in SCOP 1.67
  
• d1orjb_ appears in SCOPe 2.06
  
• d1orjb_ appears in the current release, SCOPe 2.08