Lineage for d1orgb_ (1org B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 538159Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 538160Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 538178Protein Pheromone binding protein PBPLma [101188] (1 species)
  7. 538179Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries)
  8. 538185Domain d1orgb_: 1org B: [93454]
    complexed with gol

Details for d1orgb_

PDB Entry: 1org (more details), 1.7 Å

PDB Description: The crystal structure of a pheromone binding protein from the cockroach Leucophaea maderae reveals a new mechanism of pheromone binding

SCOP Domain Sequences for d1orgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1orgb_ a.39.2.1 (B:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae)}
stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega
iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy

SCOP Domain Coordinates for d1orgb_:

Click to download the PDB-style file with coordinates for d1orgb_.
(The format of our PDB-style files is described here.)

Timeline for d1orgb_: