![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins) |
![]() | Protein Pheromone binding protein PBPLma [101188] (1 species) |
![]() | Species Madeira cockroach (Leucophaea maderae) [TaxId:36963] [101189] (3 PDB entries) |
![]() | Domain d1orgb_: 1org B: [93454] complexed with gol |
PDB Entry: 1org (more details), 1.7 Å
SCOP Domain Sequences for d1orgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orgb_ a.39.2.1 (B:) Pheromone binding protein PBPLma {Madeira cockroach (Leucophaea maderae)} stqsykdamgplvrecmgsvsateddfktvlnrnplesrtaqcllacaldkvglispega iytgddlmpvmnrlygfndfktvmkakavndcanqvngaypdrcdliknftdcvrnsy
Timeline for d1orgb_: