Lineage for d1or4b_ (1or4 B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758476Protein Heme-based aerotactic transducer HemAT, sensor domain [100980] (1 species)
  7. 758477Species Bacillus subtilis [TaxId:1423] [100981] (2 PDB entries)
  8. 758479Domain d1or4b_: 1or4 B: [93448]
    complexed with cyn, hem

Details for d1or4b_

PDB Entry: 1or4 (more details), 2.15 Å

PDB Description: Crystal Structure of HemAT sensor domain from B.subtilis in the cyano-liganded form
PDB Compounds: (B:) Heme-based aerotactic transducer hemAT

SCOP Domain Sequences for d1or4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1or4b_ a.1.1.2 (B:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}
qknriqltnkhadvkkqlkmvrlgdaelyvleqlqpliqenivnivdafyknldhesslm
diindhssvdrlkqtlkrhiqemfagviddefiekrnriasihlrigllpkwymgafqel
llsmidiyeasitnqqellkaikattkilnleqqlvle

SCOP Domain Coordinates for d1or4b_:

Click to download the PDB-style file with coordinates for d1or4b_.
(The format of our PDB-style files is described here.)

Timeline for d1or4b_: