Lineage for d1oqya2 (1oqy A:317-360)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1723911Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1723935Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1723936Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1723946Protein DNA repair protein Hhr23a [46936] (1 species)
  7. 1723947Species Human (Homo sapiens) [TaxId:9606] [46937] (5 PDB entries)
  8. 1723954Domain d1oqya2: 1oqy A:317-360 [93440]
    Other proteins in same PDB: d1oqya3, d1oqya4
    flexible linkers excluded

Details for d1oqya2

PDB Entry: 1oqy (more details)

PDB Description: structure of the dna repair protein hhr23a
PDB Compounds: (A:) uv excision repair protein rad23 homolog a

SCOPe Domain Sequences for d1oqya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]}
tpqekeaierlkalgfpeslviqayfaceknenlaanfllsqnf

SCOPe Domain Coordinates for d1oqya2:

Click to download the PDB-style file with coordinates for d1oqya2.
(The format of our PDB-style files is described here.)

Timeline for d1oqya2: