Lineage for d1oqud_ (1oqu D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729327Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 1729340Species Corynebacterium ammoniagenes [TaxId:1697] [69006] (6 PDB entries)
  8. 1729356Domain d1oqud_: 1oqu D: [93438]
    complexed with act, fe, oxy

Details for d1oqud_

PDB Entry: 1oqu (more details), 2 Å

PDB Description: a protein coordinated tri-nuclear fe complex formed during soaking of crystals of the ribonucleotide reductase r2f protein from corynebacterium ammoniagenes
PDB Compounds: (D:) Ribonucleotide reductase subunit R2F

SCOPe Domain Sequences for d1oqud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqud_ a.25.1.2 (D:) Ribonucleotide reductase R2 {Corynebacterium ammoniagenes [TaxId: 1697]}
sneydeyianhtdpvkainwnvipdekdlevwdrltgnfwlpekipvsndiqswnkmtpq
eqlatmrvftgltlldtiqgtvgaisllpdaetmheeavytniafmesvhaksysnifmt
lastpqineafrwseenenlqrkakiimsyyngddplkkkvastllesflfysgfylpmy
lssrakltntadiirliirdesvhgyyigykyqqgvkklseaeqeeykaytfdlmydlye
neieytediyddlgwtedvkrflrynankalnnlgyeglfptdetkvspailssls

SCOPe Domain Coordinates for d1oqud_:

Click to download the PDB-style file with coordinates for d1oqud_.
(The format of our PDB-style files is described here.)

Timeline for d1oqud_: