Lineage for d1oqsh_ (1oqs H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733220Species Siamese russell's viper (Daboia russelli siamensis), RV4 catalytic subunit [TaxId:343250] [101485] (1 PDB entry)
  8. 2733224Domain d1oqsh_: 1oqs H: [93434]
    complex with inhibitory subunit

Details for d1oqsh_

PDB Entry: 1oqs (more details), 1.9 Å

PDB Description: Crystal Structure of RV4/RV7 Complex
PDB Compounds: (H:) Phospholipase A2 RV-4

SCOPe Domain Sequences for d1oqsh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqsh_ a.133.1.2 (H:) Snake phospholipase A2 {Siamese russell's viper (Daboia russelli siamensis), RV4 catalytic subunit [TaxId: 343250]}
nlfqfarmingklgafsvwnyisygcycgwggqgtpkdatdrccfvhdccyggvkgcnpk
laiysysfqrgnivcgrnngclrticecdrvaancfhqnkntynkeykflssskcrqrse
qc

SCOPe Domain Coordinates for d1oqsh_:

Click to download the PDB-style file with coordinates for d1oqsh_.
(The format of our PDB-style files is described here.)

Timeline for d1oqsh_: