SCOPe 2.07: Domain d1opza1: 1opz A:1-74

Lineage for d1opza1 (1opz A:1-74)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein Potential copper-translocating P-type ATPase CopA (YvgX) [75441] (1 species)
   duplication: contains tandem repeat of two HMA domains in the N-terminal region

7. Species Bacillus subtilis [TaxId:1423] [75442] (6 PDB entries)

8. Domain d1opza1: 1opz A:1-74 [93407]
   Other proteins in same PDB: d1opza2
   domain 1
   mutant

Details for d1opza1

PDB Entry: 1opz

PDB Description: a core mutation affecting the folding properties of a soluble domain of the atpase protein copa from bacillus subtilis

PDB Compounds: (A:) Potential copper-transporting ATPase

SCOPe Domain Sequences for d1opza1:

Sequence; same for both SEQRES and ATOM records:

>d1opza1 d.58.17.1 (A:1-74) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]}
mlseqkeiamqvsgmtcaacaariekglkrmpgvtdanvnlatetvnviydpaetgtaai
qekieklgyhvvie

Timeline for d1opza1:

• d1opza1 first appeared in SCOP 1.67, called d1opza_
  
• d1opza1 appears in SCOPe 2.06
  
• d1opza1 appears in the current release, SCOPe 2.08