SCOP 1.67: Domain d1opea1: 1ope A:262-481

Lineage for d1opea1 (1ope A:262-481)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.124: NagB/RpiA/CoA transferase [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase [100950] (4 families)

5. Family c.124.1.3: CoA transferase beta subunit-like [74657] (2 proteins)
   catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest

6. Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [82467] (5 PDB entries)

8. Domain d1opea1: 1ope A:262-481 [93400]
   Other proteins in same PDB: d1opea2, d1opeb2

Details for d1opea1

PDB Entry: 1ope, 2.5 Å

PDB Description: deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart

SCOP Domain Sequences for d1opea1:

Sequence, based on SEQRES records:

>d1opea1 c.124.1.3 (A:262-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
vreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnevd
adlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgklv
kgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdr
kkgltlielwegltvddikkstgcdfavspklipmqqvtt

Sequence, based on observed residues (ATOM records):

>d1opea1 c.124.1.3 (A:262-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
vreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqnevd
adlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmivkgmg
gamdlvssaktkvvvtmehsahkimekctlpltgkqcvnriitekavfdvdrkkgltlie
lwegltvddikkstgcdfavspklipmqqvtt

Timeline for d1opea1:

• d1opea1 is new in SCOP 1.67
  
• d1opea1 appears in SCOP 1.69
  
• d1opea1 appears in the current release, SCOPe 2.08