Lineage for d1op9b_ (1op9 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1013457Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1013515Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1013839Species Human (Homo sapiens) [TaxId:9606] [53969] (208 PDB entries)
    Uniprot P00695
  8. 1014007Domain d1op9b_: 1op9 B: [93399]
    Other proteins in same PDB: d1op9a_

Details for d1op9b_

PDB Entry: 1op9 (more details), 1.86 Å

PDB Description: complex of human lysozyme with camelid vhh hl6 antibody fragment
PDB Compounds: (B:) Lysozyme C

SCOPe Domain Sequences for d1op9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op9b_ d.2.1.2 (B:) Lysozyme {Human (Homo sapiens) [TaxId: 9606]}
kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
vrqyvqgcgv

SCOPe Domain Coordinates for d1op9b_:

Click to download the PDB-style file with coordinates for d1op9b_.
(The format of our PDB-style files is described here.)

Timeline for d1op9b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1op9a_