SCOP 1.67: Domain d1op9a_: 1op9 A:

Lineage for d1op9a_ (1op9 A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species)

7. Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (12 PDB entries)

8. Domain d1op9a_: 1op9 A: [93398]
   Other proteins in same PDB: d1op9b_
   anti-lysozyme Hl6 VHh domain

Details for d1op9a_

PDB Entry: 1op9, 1.86 Å

PDB Description: complex of human lysozyme with camelid vhh hl6 antibody fragment

SCOP Domain Sequences for d1op9a_:

Sequence; same for both SEQRES and ATOM records:

>d1op9a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)}
qvqlqesgggsvqaggslrlscsasgytyisgwfrqapgkeregvaairssdgttyyads
vkgrftisqdnakntvylqmnslkpedtamyycaatevagwpldigiydywgqgtevtvs
s

Timeline for d1op9a_:

• d1op9a_ is new in SCOP 1.67
  
• d1op9a_ appears in SCOP 1.69
  
• d1op9a_ appears in the current release, SCOPe 2.08, called d1op9a1