Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species) |
Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (12 PDB entries) |
Domain d1op9a_: 1op9 A: [93398] Other proteins in same PDB: d1op9b_ anti-lysozyme Hl6 VHh domain |
PDB Entry: 1op9 (more details), 1.86 Å
SCOP Domain Sequences for d1op9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op9a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius)} qvqlqesgggsvqaggslrlscsasgytyisgwfrqapgkeregvaairssdgttyyads vkgrftisqdnakntvylqmnslkpedtamyycaatevagwpldigiydywgqgtevtvs s
Timeline for d1op9a_: