Lineage for d1oozb1 (1ooz B:260-481)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 496441Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 496442Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) (S)
  5. 496498Family c.124.1.3: CoA transferase beta subunit-like [74657] (2 proteins)
    catalytic subunit: similar active site structure to the NagB and RpiA families; mixed beta-sheet of 7 strands, order 4321567; strand 3 is antiparallel to the rest
  6. 496503Protein Succinate:CoA transferase, C-terminal domain [82466] (1 species)
  7. 496504Species Pig (Sus scrofa) [TaxId:9823] [82467] (5 PDB entries)
  8. 496508Domain d1oozb1: 1ooz B:260-481 [93394]
    Other proteins in same PDB: d1ooza2, d1oozb2

Details for d1oozb1

PDB Entry: 1ooz (more details), 2.1 Å

PDB Description: deletion mutant of succinyl-coa:3-ketoacid coa transferase from pig heart

SCOP Domain Sequences for d1oozb1:

Sequence, based on SEQRES records: (download)

>d1oozb1 c.124.1.3 (B:260-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne
vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmipgk
lvkgmggamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdv
drkkgltlielwegltvddikkstgcdfavspklipmqqvtt

Sequence, based on observed residues (ATOM records): (download)

>d1oozb1 c.124.1.3 (B:260-481) Succinate:CoA transferase, C-terminal domain {Pig (Sus scrofa)}
dnvreriikraalefedgmyanlgigipllasnfispnmtvhlqsengilglgpyplqne
vdadlinagketvtvlpgasyfssdesfamirgghvnltmlgamqvskygdlanwmkgmg
gamdlvssaktkvvvtmehsakgnahkimekctlpltgkqcvnriitekavfdvdrkkgl
tlielwegltvddikkstgcdfavspklipmqqvtt

SCOP Domain Coordinates for d1oozb1:

Click to download the PDB-style file with coordinates for d1oozb1.
(The format of our PDB-style files is described here.)

Timeline for d1oozb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oozb2