Lineage for d1ooga_ (1oog A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 538159Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 538160Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 538169Protein Odorant binding protein LUSH [101190] (1 species)
  7. 538170Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (4 PDB entries)
  8. 538173Domain d1ooga_: 1oog A: [93381]

Details for d1ooga_

PDB Entry: 1oog (more details), 1.45 Å

PDB Description: Complex of Drosophila odorant binding protein LUSH with propanol

SCOP Domain Sequences for d1ooga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooga_ a.39.2.1 (A:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster)}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

SCOP Domain Coordinates for d1ooga_:

Click to download the PDB-style file with coordinates for d1ooga_.
(The format of our PDB-style files is described here.)

Timeline for d1ooga_: