Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (4 species) Class I MHC-related |
Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (3 PDB entries) |
Domain d1onqc2: 1onq C:7-183 [93369] Other proteins in same PDB: d1onqa1, d1onqb_, d1onqc1, d1onqd_ complexed with fuc, nag, slf |
PDB Entry: 1onq (more details), 2.15 Å
SCOPe Domain Sequences for d1onqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onqc2 d.19.1.1 (C:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]} plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr
Timeline for d1onqc2:
View in 3D Domains from other chains: (mouse over for more information) d1onqa1, d1onqa2, d1onqb_, d1onqd_ |