SCOPe 2.05: Domain d1onqc1: 1onq C:184-279

Lineage for d1onqc1 (1onq C:184-279)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein CD1, alpha-3 domain [88615] (5 species)

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)

8. Domain d1onqc1: 1onq C:184-279 [93368]
   Other proteins in same PDB: d1onqa2, d1onqb_, d1onqc2, d1onqd_
   complexed with fuc, nag, slf

Details for d1onqc1

PDB Entry: 1onq, 2.15 Å

PDB Description: crystal structure of cd1a in complex with a sulfatide

PDB Compounds: (C:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1onqc1:

Sequence; same for both SEQRES and ATOM records:

>d1onqc1 b.1.1.2 (C:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywhh

Timeline for d1onqc1:

• d1onqc1 first appeared in SCOP 1.67
  
• d1onqc1 appears in SCOPe 2.04
  
• d1onqc1 appears in SCOPe 2.06
  
• d1onqc1 appears in the current release, SCOPe 2.08