![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein CD1, alpha-3 domain [88615] (5 species) |
![]() | Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries) |
![]() | Domain d1onqc1: 1onq C:184-277 [93368] Other proteins in same PDB: d1onqa2, d1onqa3, d1onqb_, d1onqc2, d1onqc3, d1onqd_ complexed with fuc, nag, slf |
PDB Entry: 1onq (more details), 2.15 Å
SCOPe Domain Sequences for d1onqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1onqc1 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw ylratlevaageaadlscrvkhsslegqdivlyw
Timeline for d1onqc1: