SCOP 1.67: Domain d1onqa2: 1onq A:7-183

Lineage for d1onqa2 (1onq A:7-183)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (3 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (1 PDB entry)

8. Domain d1onqa2: 1onq A:7-183 [93366]
   Other proteins in same PDB: d1onqa1, d1onqb_, d1onqc1, d1onqd_

Details for d1onqa2

PDB Entry: 1onq, 2.15 Å

PDB Description: crystal structure of cd1a in complex with a sulfatide

SCOP Domain Sequences for d1onqa2:

Sequence; same for both SEQRES and ATOM records:

>d1onqa2 d.19.1.1 (A:7-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a}
plsfhviwiasfynhswkqnlvsgwlsdlqthtwdsnsstivflwpwsrgnfsneewkel
etlfrirtirsfegirryahelqfeypfeiqvtggcelhsgkvsgsflqlayqgsdfvsf
qnnswlpypvagnmakhfckvlnqnqhendithnllsdtcprfilglldagkahlqr

Timeline for d1onqa2:

• d1onqa2 is new in SCOP 1.67
  
• d1onqa2 appears in SCOP 1.69
  
• d1onqa2 appears in the current release, SCOPe 2.08