Lineage for d1onqa1 (1onq A:184-277)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026128Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2026133Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)
  8. 2026134Domain d1onqa1: 1onq A:184-277 [93365]
    Other proteins in same PDB: d1onqa2, d1onqa3, d1onqb_, d1onqc2, d1onqc3, d1onqd_
    complexed with fuc, nag, slf

Details for d1onqa1

PDB Entry: 1onq (more details), 2.15 Å

PDB Description: crystal structure of cd1a in complex with a sulfatide
PDB Compounds: (A:) T-cell surface glycoprotein CD1a

SCOPe Domain Sequences for d1onqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onqa1 b.1.1.2 (A:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d1onqa1:

Click to download the PDB-style file with coordinates for d1onqa1.
(The format of our PDB-style files is described here.)

Timeline for d1onqa1: