SCOP 1.67: Domain d1onqa1: 1onq A:184-280

Lineage for d1onqa1 (1onq A:184-280)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein CD1, alpha-3 domain [88615] (3 species)

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (1 PDB entry)

8. Domain d1onqa1: 1onq A:184-280 [93365]
   Other proteins in same PDB: d1onqa2, d1onqb_, d1onqc2, d1onqd_

Details for d1onqa1

PDB Entry: 1onq, 2.15 Å

PDB Description: crystal structure of cd1a in complex with a sulfatide

SCOP Domain Sequences for d1onqa1:

Sequence; same for both SEQRES and ATOM records:

>d1onqa1 b.1.1.2 (A:184-280) CD1, alpha-3 domain {Human (Homo sapiens), CD1a}
qvkpeawlshgpspgpghlqlvchvsgfypkpvwvmwmrgeqeqqgtqrgdilpsadgtw
ylratlevaageaadlscrvkhsslegqdivlywhhh

Timeline for d1onqa1:

• d1onqa1 is new in SCOP 1.67
  
• d1onqa1 appears in SCOP 1.69
  
• d1onqa1 appears in the current release, SCOPe 2.08