Lineage for d1onha_ (1onh A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450076Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1450083Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (9 PDB entries)
    Uniprot P05364 22-380 ! Uniprot P05364 22-381
  8. 1450085Domain d1onha_: 1onh A: [93357]
    complexed with gol, wy4

Details for d1onha_

PDB Entry: 1onh (more details), 1.38 Å

PDB Description: gc1 beta-lactamase with a penem inhibitor
PDB Compounds: (A:) class C beta-lactamase

SCOPe Domain Sequences for d1onha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
pvsekqlaevvantvtplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddpvtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavravrvspgmldaqaygvktnvqdmanwvmanm
apenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpv
aevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhile
alq

SCOPe Domain Coordinates for d1onha_:

Click to download the PDB-style file with coordinates for d1onha_.
(The format of our PDB-style files is described here.)

Timeline for d1onha_: