Lineage for d1olxb2 (1olx B:205-342)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 396644Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 396645Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 396676Family c.48.1.2: Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain [52926] (3 proteins)
  6. 396680Protein Branched-chain alpha-keto acid dehydrogenase [52927] (2 species)
  7. 396681Species Human (Homo sapiens) [TaxId:9606] [52928] (4 PDB entries)
  8. 396684Domain d1olxb2: 1olx B:205-342 [93340]
    Other proteins in same PDB: d1olxa_, d1olxb1
    complexed with gol, k, mn, tdp; mutant

Details for d1olxb2

PDB Entry: 1olx (more details), 2.25 Å

PDB Description: roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase

SCOP Domain Sequences for d1olxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olxb2 c.48.1.2 (B:205-342) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)}
pyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevidlrtiipwdvdt
icksviktgrllisheapltggfaseisstvqeecflnleapisrvcgydtpfphifepf
yipdkwkcydalrkminy

SCOP Domain Coordinates for d1olxb2:

Click to download the PDB-style file with coordinates for d1olxb2.
(The format of our PDB-style files is described here.)

Timeline for d1olxb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1olxb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1olxa_