SCOP 1.67: Domain d1olub1: 1olu B:2-204

Lineage for d1olub1 (1olu B:2-204)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (3 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module

6. Protein Branched-chain alpha-keto acid dehydrogenase, Pyr module [88742] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88743] (4 PDB entries)

8. Domain d1olub1: 1olu B:2-204 [93336]
   Other proteins in same PDB: d1olua_, d1olub2
   complexed with gol, k, mg, tdp; mutant

Details for d1olub1

PDB Entry: 1olu, 1.9 Å

PDB Description: roles of his291-alpha and his146-beta' in the reductive acylation reaction catalyzed by human branched-chain alpha-ketoacid dehydrogenase

SCOP Domain Sequences for d1olub1:

Sequence, based on SEQRES records:

>d1olub1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens)}
ahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglr
dkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrs
gdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscied
knpciffepkilyraaaeevpie

Sequence, based on observed residues (ATOM records):

>d1olub1 c.36.1.7 (B:2-204) Branched-chain alpha-keto acid dehydrogenase, Pyr module {Human (Homo sapiens)}
ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
ffepkilyraaaeevpie

Timeline for d1olub1:

• d1olub1 is new in SCOP 1.67
  
• d1olub1 appears in SCOP 1.69
  
• d1olub1 appears in the current release, SCOPe 2.08