| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Ligand binding domain of NK receptor NKp46 [101519] (1 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens) [TaxId:9606] [101520] (2 PDB entries) |
| Domain d1olla1: 1oll A:1-95 [93313] complexed with edo |
PDB Entry: 1oll (more details), 1.93 Å
SCOPe Domain Sequences for d1olla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]}
tlpkpfiwaephfmvpkekqvticcqgnygaveyqlhfegslfavdrpkpperinkvkfy
ipdmnsrmagqysciyrvgelwsepsnlldlvvte
Timeline for d1olla1: