Lineage for d1olla1 (1oll A:1-95)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518935Protein Ligand binding domain of NK receptor NKp46 [101519] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1518936Species Human (Homo sapiens) [TaxId:9606] [101520] (2 PDB entries)
  8. 1518937Domain d1olla1: 1oll A:1-95 [93313]
    complexed with edo

Details for d1olla1

PDB Entry: 1oll (more details), 1.93 Å

PDB Description: extracellular region of the human receptor nkp46
PDB Compounds: (A:) nk receptor

SCOPe Domain Sequences for d1olla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]}
tlpkpfiwaephfmvpkekqvticcqgnygaveyqlhfegslfavdrpkpperinkvkfy
ipdmnsrmagqysciyrvgelwsepsnlldlvvte

SCOPe Domain Coordinates for d1olla1:

Click to download the PDB-style file with coordinates for d1olla1.
(The format of our PDB-style files is described here.)

Timeline for d1olla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1olla2